PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400013088
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 149aa    MW: 17114.7 Da    PI: 9.105
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400013088genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.62.2e-30959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krien+snrqvt+skRrngilKKA+E+SvLCda v+viif+++gk++e+ss
  PGSC0003DMP400013088  9 KRIENSSNRQVTYSKRRNGILKKAKEISVLCDAHVSVIIFATSGKMHEFSS 59
                          79***********************************************96 PP

2K-box75.51.5e-2569138170
                 K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                           y+k +g++l++ak+e+l++e++k+kk ++n+q e+Rhl+Ged++sL+++eL+ Le++Le +l+ iR+k+ 
  PGSC0003DMP400013088  69 YHKLTGRRLWDAKHENLDNEINKVKKDNDNMQIELRHLKGEDISSLNYRELMILEDALEIGLTGIRDKQV 138
                           7899999************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.693161IPR002100Transcription factor, MADS-box
CDDcd002652.73E-41278No hitNo description
SuperFamilySSF554551.11E-35294IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.6E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-283859IPR002100Transcription factor, MADS-box
PfamPF014862.5E-1580137IPR002487Transcription factor, K-box
PROSITE profilePS5129710.71482148IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT YSKRRNGILK KAKEISVLCD AHVSVIIFAT SGKMHEFSST  60
PLVDILDQYH KLTGRRLWDA KHENLDNEIN KVKKDNDNMQ IELRHLKGED ISSLNYRELM  120
ILEDALEIGL TGIRDKQVPT ILYFCVFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A5e-18269168Myocyte-specific enhancer factor 2A
3mu6_B5e-18269168Myocyte-specific enhancer factor 2A
3mu6_C5e-18269168Myocyte-specific enhancer factor 2A
3mu6_D5e-18269168Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8534171e-179HQ853417.1 Iochroma cyaneum MADS box transcription factor (GLO1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361522.15e-96PREDICTED: floral homeotic protein FBP1
SwissprotQ034168e-90GLOB_TOBAC; Floral homeotic protein GLOBOSA
TrEMBLM1ABK81e-106M1ABK8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000190702e-95(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-63MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]